CacheBy
Atlas Antibodies Anti-SLC1A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC1A2 Antibody

상품 한눈에 보기

Human SLC1A2 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 orthogonal validation에 적합함. EAAT2/GLT-1 대체명으로 알려진 glial 고친화성 glutamate transporter 검출에 사용. PrEST 항원 기반 affinity purification으로 높은 특이성과 재현성 제공.

카탈로그번호
HPA009172-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009172-100 Anti-SLC1A2 Antibody, solute carrier family 1 (glial high affinity glutamate transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009172-25 Anti-SLC1A2 Antibody, solute carrier family 1 (glial high affinity glutamate transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC1A2 Antibody

Anti-SLC1A2 Antibody

Target: solute carrier family 1 (glial high affinity glutamate transporter), member 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SLC1A2


Alternative Gene Names

  • EAAT2
  • GLT-1

Open Datasheet


Specifications

항목 내용
Target Protein solute carrier family 1 (glial high affinity glutamate transporter), member 2
Target Gene SLC1A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000005089 (87%), Rat ENSRNOG00000014816 (48%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.