Atlas Antibodies Anti-SLC17A9 Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA056499-100 | Atlas Antibodies HPA056499-100 Anti-SLC17A9 Antibody, solute carrier family 17 (vesicular nucleotide transporter), member 9 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA056499-25 | Atlas Antibodies HPA056499-25 Anti-SLC17A9 Antibody, solute carrier family 17 (vesicular nucleotide transporter), member 9 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-SLC17A9 Antibody
solute carrier family 17 (vesicular nucleotide transporter), member 9
Recommended Applications
Product Description
Polyclonal Antibody against Human SLC17A9
Alternative Gene Names
C20orf59, FLJ23412, VNUT
Target Protein
solute carrier family 17 (vesicular nucleotide transporter), member 9
Target Gene
SLC17A9
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KDLILALGVLAQSRPVSRHSRVPWRRLFRKPA
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000010275 (72%)
Mouse ENSMUSG00000023393 (66%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|