원본

Atlas Antibodies Anti-SLC17A9 Antibody

상품 한눈에 보기

인간 SLC17A9 단백질을 인식하는 폴리클로날 항체입니다. Rabbit에서 생산된 IgG 형식으로, PrEST 항원으로 친화 정제되었습니다. ICC 등 다양한 응용에 적합하며, Human에 대해 검증된 반응성을 가집니다. PBS와 glycerol buffer로 안정화되어 있습니다.

카탈로그번호: HPA056499-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056499-100 Anti-SLC17A9 Antibody, solute carrier family 17 (vesicular nucleotide transporter), member 9 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056499-25 Anti-SLC17A9 Antibody, solute carrier family 17 (vesicular nucleotide transporter), member 9 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC17A9 Antibody

Anti-SLC17A9 Antibody

Target: solute carrier family 17 (vesicular nucleotide transporter), member 9
Supplier: Atlas Antibodies

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC17A9.

Alternative Gene Names

C20orf59
FLJ23412
VNUT

Open Datasheet (PDF)

Target Information

Target Protein: solute carrier family 17 (vesicular nucleotide transporter), member 9
Target Gene: SLC17A9

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KDLILALGVLAQSRPVSRHSRVPWRRLFRKPA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000010275	72%
Mouse	ENSMUSG00000023393	66%

Antibody Specifications

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand