Atlas Antibodies Anti-SLC13A3 Antibody

상품 한눈에 보기

인간 SLC13A3 단백질에 대한 고품질 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되었습니다.

카탈로그번호: HPA014353-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014353-100 Anti-SLC13A3 Antibody, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014353-25 Anti-SLC13A3 Antibody, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC13A3 Antibody

Anti-SLC13A3 Antibody

Target: Solute carrier family 13 member 3 (SLC13A3)
Supplier: Atlas Antibodies

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SLC13A3.

Alternative Gene Names

NADC3
SDCT2

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVP

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000019118	93%
Mouse	ENSMUSG00000018459	93%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand