
원본
Atlas Antibodies Anti-SLC11A2 Antibody
상품 한눈에 보기
Human SLC11A2 단백질을 인식하는 Rabbit Polyclonal 항체로, 금속 이온 수송 관련 연구에 적합. DCT1/DMT1/NRAMP2 대체명으로 알려진 단백질 타겟. PrEST 항원으로 정제되었으며, 인체 반응성이 검증됨. PBS/glycerol buffer에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA032139-100 Anti-SLC11A2 Antibody, solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032139-25 Anti-SLC11A2 Antibody, solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SLC11A2 Antibody
Anti-SLC11A2 Antibody
Target: solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal Antibody against Human SLC11A2
Alternative Gene Names
- DCT1
- DMT1
- NRAMP2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2 |
| Target Gene | SLC11A2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000019550 (83%), Mouse ENSMUSG00000023030 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



