Atlas Antibodies Anti-SLC10A6 Antibody

상품 한눈에 보기

Human SLC10A6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인함. PrEST 항원으로 정제된 고품질 항체이며, 인체 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA016662-100 Anti-SLC10A6 Antibody, solute carrier family 10 (sodium/bile acid cotransporter), member 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA016662-25 Anti-SLC10A6 Antibody, solute carrier family 10 (sodium/bile acid cotransporter), member 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

solute carrier family 10 (sodium/bile acid cotransporter), member 6

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human SLC10A6

SOAT

항목	내용
Target Protein	solute carrier family 10 (sodium/bile acid cotransporter), member 6
Target Gene	SLC10A6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000029321 (44%), Rat ENSRNOG00000002057 (33%)

Antigen Sequence

KRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand