CacheBy
Atlas Antibodies Anti-SLA Antibody
원본

Atlas Antibodies Anti-SLA Antibody

상품 한눈에 보기

Human SLA 단백질을 표적으로 하는 Rabbit Polyclonal Anti-SLA 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074192-100 Anti-SLA Antibody, Src-like-adaptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074192-25 Anti-SLA Antibody, Src-like-adaptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLA Antibody

Anti-SLA Antibody

Target Information

  • Target Protein: Src-like-adaptor
  • Target Gene: SLA
  • Alternative Gene Names: SLA1

Product Description

Polyclonal Antibody against Human SLA.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000056714 (95%)
  • Mouse ENSMUSG00000022372 (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)
Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.