CacheBy
Atlas Antibodies Anti-SLA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLA2 Antibody

상품 한눈에 보기

Human SLA2 단백질을 인식하는 Rabbit polyclonal 항체. Src-like-adaptor 2 단백질 검출용으로 개발됨. ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제됨. Human에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053746-100 Anti-SLA2 Antibody, Src-like-adaptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053746-25 Anti-SLA2 Antibody, Src-like-adaptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLA2 Antibody

Anti-SLA2 Antibody

Target Information

  • Target Protein: Src-like-adaptor 2
  • Target Gene: SLA2
  • Alternative Gene Names: C20orf156, FLJ21992, SLAP-2

Product Description

Polyclonal antibody against Human SLA2, developed for detection of Src-like-adaptor 2 protein.

Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000027636 (84%)
  • Rat ENSRNOG00000020337 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 조건은 사용자가 직접 확인해야 합니다.

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.