CacheBy
Atlas Antibodies Anti-SIGMAR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SIGMAR1 Antibody

상품 한눈에 보기

Human SIGMAR1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합. Orthogonal validation을 통해 단백질 발현 검증. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 재현성을 보장. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018002-100 Anti-SIGMAR1 Antibody, sigma non-opioid intracellular receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018002-25 Anti-SIGMAR1 Antibody, sigma non-opioid intracellular receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SIGMAR1 Antibody

Anti-SIGMAR1 Antibody

Target: sigma non-opioid intracellular receptor 1 (SIGMAR1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)

Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human SIGMAR1

Alternative Gene Names

OPRS1, SR-BP1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein sigma non-opioid intracellular receptor 1
Target Gene SIGMAR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
Verified Species Reactivity Human
Interspecies Identity Rat (100%), Mouse (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.