Atlas Antibodies Anti-SIGMAR1 Antibody

상품 한눈에 보기

인간 SIGMAR1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 정교한 orthogonal 검증 수행. 고순도 Affinity 정제 및 안정화 버퍼 포함. 인간, 쥐, 랫드에 높은 교차 반응성 확인.

카탈로그번호: HPA024071-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024071-100 Anti-SIGMAR1 Antibody, sigma non-opioid intracellular receptor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024071-25 Anti-SIGMAR1 Antibody, sigma non-opioid intracellular receptor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SIGMAR1 Antibody

Anti-SIGMAR1 Antibody

Target: sigma non-opioid intracellular receptor 1 (SIGMAR1)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)

Orthogonal validation:
Protein expression verified by WB and compared with RNA-seq data of corresponding targets in high and low expression cell lines.

Product Description

Polyclonal antibody against human SIGMAR1.

Alternative Gene Names

OPRS1
SR-BP1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	sigma non-opioid intracellular receptor 1
Target Gene	SIGMAR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000014604 (100%), Mouse ENSMUSG00000036078 (98%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet