CacheBy
Atlas Antibodies Anti-SIGMAR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SIGMAR1 Antibody

상품 한눈에 보기

인간 SIGMAR1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 정교한 orthogonal 검증 수행. 고순도 Affinity 정제 및 안정화 버퍼 포함. 인간, 쥐, 랫드에 높은 교차 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024071-100 Anti-SIGMAR1 Antibody, sigma non-opioid intracellular receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024071-25 Anti-SIGMAR1 Antibody, sigma non-opioid intracellular receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SIGMAR1 Antibody

Anti-SIGMAR1 Antibody

Target: sigma non-opioid intracellular receptor 1 (SIGMAR1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)

Orthogonal validation:
Protein expression verified by WB and compared with RNA-seq data of corresponding targets in high and low expression cell lines.


Product Description

Polyclonal antibody against human SIGMAR1.


Alternative Gene Names

  • OPRS1
  • SR-BP1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein sigma non-opioid intracellular receptor 1
Target Gene SIGMAR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000014604 (100%), Mouse ENSMUSG00000036078 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.