CacheBy
Atlas Antibodies Anti-SIGLEC6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SIGLEC6 Antibody

상품 한눈에 보기

인간 SIGLEC6 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형태로 다양한 면역학적 연구에 적합. 고순도 Affinity 정제 방식 적용. 인간 특이적 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009084-100 Anti-SIGLEC6 Antibody, sialic acid binding Ig-like lectin 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009084-25 Anti-SIGLEC6 Antibody, sialic acid binding Ig-like lectin 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SIGLEC6 Antibody

Anti-SIGLEC6 Antibody

Target Protein: sialic acid binding Ig like lectin 6
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SIGLEC6

Alternative Gene Names

CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6

Open Datasheet

Target Information

  • Target Protein: sialic acid binding Ig like lectin 6
  • Target Gene: SIGLEC6

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000030474 (35%)
  • Rat ENSRNOG00000022640 (32%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.