CacheBy
Atlas Antibodies Anti-SHTN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SHTN1 Antibody

상품 한눈에 보기

Human SHTN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증을 통해 단백질 발현을 확인. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장. 뇌 조직 연구 및 신경 발달 관련 단백질 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037943-100 Anti-SHTN1 Antibody, shootin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037943-25 Anti-SHTN1 Antibody, shootin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SHTN1 Antibody

Anti-SHTN1 Antibody

Target Protein: shootin 1
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human SHTN1 (shootin 1).
Validated for use in immunohistochemistry (IHC) and western blot (WB) applications.


Validation Information

  • Orthogonal validation (IHC): Protein expression verified by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Independent antibody validation (WB): Protein expression confirmed by comparing independent antibodies targeting different epitopes of the protein.

Alternative Gene Names

KIAA1598, shootin-1, shootin1


Target Information

항목 내용
Target Protein shootin 1
Target Gene SHTN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NRVSMLAVEEYEEMQVNLELEKDLRKKAESFAQEMFIEQNKLKRQSHLLLQSSIPDQQLLKALDENAKLTQQLEEERIQHQQK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000041362 (95%), Rat ENSRNOG00000018350 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.