
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EML4 Antibody
상품 한눈에 보기
Human EML4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증. Affinity purification 방식으로 높은 특이성과 재현성 보장. 다양한 조직에서 EML4 발현 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036687-100 Anti-EML4 Antibody, echinoderm microtubule associated protein like 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036687-25 Anti-EML4 Antibody, echinoderm microtubule associated protein like 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EML4 Antibody
Anti-EML4 Antibody
echinoderm microtubule associated protein like 4
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human EML4
Alternative Gene Names
C2orf2, ELP120, ROPP120
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | echinoderm microtubule associated protein like 4 |
| Target Gene | EML4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKSHNSWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQEGEY |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity to orthologs: Rat ENSRNOG00000030294 (73%), Mouse ENSMUSG00000032624 (71%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



