CacheBy
Atlas Antibodies Anti-EMC8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EMC8 Antibody

상품 한눈에 보기

Human EMC8 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, 40% glycerol 기반의 안정한 PBS buffer로 보관됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049476-100 Anti-EMC8 Antibody, ER membrane protein complex subunit 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049476-25 Anti-EMC8 Antibody, ER membrane protein complex subunit 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EMC8 Antibody

Anti-EMC8 Antibody

Target: ER membrane protein complex subunit 8
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human EMC8 protein.


Alternative Gene Names

C16orf2, C16orf4, COX4NB, FAM158B, NOC4


Target Information

항목 내용
Target Protein ER membrane protein complex subunit 8
Target Gene EMC8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVD
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000017654 (83%), Mouse ENSMUSG00000031819 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Material Safety Data Sheet MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.