CacheBy
Atlas Antibodies Anti-EMC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EMC4 Antibody

상품 한눈에 보기

인간 EMC4 단백질을 인식하는 폴리클로날 항체로 ER 막 단백질 복합체 연구에 적합함. 토끼 유래 IgG 형식이며, 높은 특이성과 재현성을 제공. 프레스트(PrEST) 항원을 이용한 친화 정제 방식으로 제조됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053440-100 Anti-EMC4 Antibody, ER membrane protein complex subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053440-25 Anti-EMC4 Antibody, ER membrane protein complex subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EMC4 Antibody

Anti-EMC4 Antibody

Target: ER membrane protein complex subunit 4
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human EMC4.


Alternative Gene Names

FLJ90746, MGC24415, PIG17, TMEM85

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ER membrane protein complex subunit 4
Target Gene EMC4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (100%), Rat (99%)

Antigen Sequence

LVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPM


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.