CacheBy
Atlas Antibodies Anti-ELP4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELP4 Antibody

상품 한눈에 보기

인간 ELP4 단백질에 대한 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. Rabbit 호스트에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 높은 반응성을 가지며, Mouse 및 Rat과도 유사성이 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038572-100 Anti-ELP4 Antibody, elongator acetyltransferase complex subunit 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038572-25 Anti-ELP4 Antibody, elongator acetyltransferase complex subunit 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELP4 Antibody

Anti-ELP4 Antibody

Target Information

  • Target Protein: elongator acetyltransferase complex subunit 4
  • Target Gene: ELP4
  • Alternative Gene Names: C11orf19, PAXNEB
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ELP4.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    YVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKD

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Mouse (ENSMUSG00000027167): 86%
    • Rat (ENSRNOG00000016146): 84%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.