CacheBy
Atlas Antibodies Anti-ELMOD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELMOD2 Antibody

상품 한눈에 보기

ELMOD2 단백질을 인식하는 인간 유래 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC, WB, ICC 실험에 적합하며 PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, 40% glycerol/PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047600-100 Anti-ELMOD2 Antibody, ELMO/CED-12 domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047600-25 Anti-ELMOD2 Antibody, ELMO/CED-12 domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELMOD2 Antibody

Anti-ELMOD2 Antibody

ELMO/CED-12 domain containing 2


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ELMOD2.


Alternative Gene Names

  • MGC10084

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ELMO/CED-12 domain containing 2
Target Gene ELMOD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000035151 70%
Rat ENSRNOG00000011225 67%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.