
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ELFN2 Antibody
상품 한눈에 보기
Human ELFN2 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit에서 제조된 IgG 형태이며, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에서 높은 교차 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000781-100 Anti-ELFN2 Antibody, extracellular leucine-rich repeat and fibronectin type III domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000781-25 Anti-ELFN2 Antibody, extracellular leucine-rich repeat and fibronectin type III domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ELFN2 Antibody
Anti-ELFN2 Antibody
Full Name: Extracellular leucine-rich repeat and fibronectin type III domain containing 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ELFN2.
Alternative Gene Names
- dJ63G5.3
- KIAA1904
- LRRC62
- PPP1R29
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Extracellular leucine-rich repeat and fibronectin type III domain containing 2 |
| Target Gene | ELFN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (100%), Rat (99%) |
Antigen Sequence:
GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



