CacheBy
Atlas Antibodies Anti-ELFN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ELFN2 Antibody

상품 한눈에 보기

Human ELFN2 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit에서 제조된 IgG 형태이며, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에서 높은 교차 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000781-100 Anti-ELFN2 Antibody, extracellular leucine-rich repeat and fibronectin type III domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000781-25 Anti-ELFN2 Antibody, extracellular leucine-rich repeat and fibronectin type III domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ELFN2 Antibody

Anti-ELFN2 Antibody

Full Name: Extracellular leucine-rich repeat and fibronectin type III domain containing 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ELFN2.

Alternative Gene Names

  • dJ63G5.3
  • KIAA1904
  • LRRC62
  • PPP1R29

Open Datasheet


Target Information

항목 내용
Target Protein Extracellular leucine-rich repeat and fibronectin type III domain containing 2
Target Gene ELFN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (100%), Rat (99%)

Antigen Sequence:
GIHHLEVKPAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWK


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.