
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-EIF6 Antibody
상품 한눈에 보기
인간 EIF6 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. 토끼 유래 IgG 항체이며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA040873-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040873-100 Anti-EIF6 Antibody, eukaryotic translation initiation factor 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040873-25 Anti-EIF6 Antibody, eukaryotic translation initiation factor 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-EIF6 Antibody
Anti-EIF6 Antibody
Target: eukaryotic translation initiation factor 6 (EIF6)
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human EIF6.
Alternative Gene Names
b(2)gcn, EIF3A, ITGB4BP, p27BBP
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000049497 | 100% |
| Mouse | ENSMUSG00000027613 | 100% |
Antibody Specifications
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



