CacheBy
Atlas Antibodies Anti-EGR4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EGR4 Antibody

상품 한눈에 보기

인간 EGR4 단백질에 특이적인 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 통한 정교한 발현 검증에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028983-100 Anti-EGR4 Antibody, early growth response 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028983-25 Anti-EGR4 Antibody, early growth response 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EGR4 Antibody

Anti-EGR4 Antibody

Target Protein: early growth response 4
Recommended Applications: IHC with orthogonal validation using RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human EGR4.

Alternative Gene Names

NGFI-C, PAT133

Open Datasheet

Target Information

  • Target Protein: early growth response 4
  • Target Gene: EGR4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000015719 79%
Mouse ENSMUSG00000071341 76%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.