Atlas Antibodies Anti-EGR4 Antibody

상품 한눈에 보기

인간 EGR4 단백질에 특이적인 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 통한 정교한 발현 검증에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human 반응성 확인.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028983-100 Anti-EGR4 Antibody, early growth response 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028983-25 Anti-EGR4 Antibody, early growth response 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-EGR4 Antibody

Anti-EGR4 Antibody

Target Protein: early growth response 4
Recommended Applications: IHC with orthogonal validation using RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human EGR4.

Alternative Gene Names

NGFI-C, PAT133

Open Datasheet

Target Information

Target Protein: early growth response 4
Target Gene: EGR4
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PWELLSVGAPGNCGSQGDYQAAPEARFPVIGTKIEDLLSISCPAELPAVPANRLYPSGAYDAFPLAPGDLGEGAEGLPGLLTPPSGEGGSSGDGGEFLASTQPQLSPLGLRSAAAADFPKPL

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000015719	79%
Mouse	ENSMUSG00000071341	76%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand