Atlas Antibodies Anti-EGLN1 Antibody

상품 한눈에 보기

Human EGLN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 추천됩니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. EGLN1 관련 연구 및 저산소 반응 경로 분석에 적합합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022129-100 Anti-EGLN1 Antibody, egl-9 family hypoxia-inducible factor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022129-25 Anti-EGLN1 Antibody, egl-9 family hypoxia-inducible factor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-EGLN1 Antibody

Anti-EGLN1 Antibody

Target: egl-9 family hypoxia-inducible factor 1 (EGLN1)
Type: Polyclonal Antibody against Human EGLN1

Recommended Applications

Immunohistochemistry (IHC)
Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human EGLN1 protein. It recognizes the egl-9 family hypoxia-inducible factor 1 and is suitable for various research applications.

Alternative Gene Names

C1orf12, HIFPH2, PHD2, SM-20, ZMYND6

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	egl-9 family hypoxia-inducible factor 1
Target Gene	EGLN1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000019773 (96%)
Mouse ENSMUSG00000031987 (94%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet