CacheBy
Atlas Antibodies Anti-EFR3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EFR3A Antibody

상품 한눈에 보기

인간 EFR3A 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. 독립적 항체 비교로 검증된 신뢰성 높은 제품. 토끼 유래 IgG, PrEST 항원으로 친화 정제됨. 인간 반응성 확인, 쥐·마우스와 높은 서열 유사성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023402-100 Anti-EFR3A Antibody, EFR3 homolog A (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023402-25 Anti-EFR3A Antibody, EFR3 homolog A (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EFR3A Antibody

Anti-EFR3A Antibody

EFR3 homolog A (S. cerevisiae)

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human EFR3A.

Alternative Gene Names

KIAA0143

Open Datasheet (PDF)

Target Information

  • Target Protein: EFR3 homolog A (S. cerevisiae)
  • Target Gene: EFR3A
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000025528 (96%)
  • Mouse ENSMUSG00000015002 (96%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet: Sodium Azide MSDS

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.