CacheBy
Atlas Antibodies Anti-EFNB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EFNB2 Antibody

상품 한눈에 보기

Human EFNB2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 다양한 종에서 높은 상동성을 보입니다. 연구용으로 ephrin-B2 단백질 분석에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008999-100 Anti-EFNB2 Antibody, ephrin-B2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008999-25 Anti-EFNB2 Antibody, ephrin-B2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EFNB2 Antibody

Anti-EFNB2 Antibody

Target Protein: ephrin-B2
Product Type: Polyclonal Antibody against Human EFNB2


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against Human EFNB2 protein (ephrin-B2).
Validated for multiple immunoassay applications.


Alternative Gene Names

EPLG5, Htk-L, HTKL, LERK5, MGC126226, MGC126227, MGC126228

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMP

Species Reactivity

Species Gene ID Sequence Identity
Human EFNB2 100%
Mouse ENSMUSG00000001300 97%
Rat ENSRNOG00000014648 97%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.