CacheBy
Atlas Antibodies Anti-EFNB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EFNB1 Antibody

상품 한눈에 보기

Human EFNB1 단백질을 인식하는 고품질 폴리클로날 항체. Rabbit에서 생산된 IgG 아이소타입으로 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대해 검증된 반응성을 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067188-100 Anti-EFNB1 Antibody, ephrin-B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067188-25 Anti-EFNB1 Antibody, ephrin-B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EFNB1 Antibody

Anti-EFNB1 Antibody

Target Information

  • Target Protein: ephrin-B1
  • Target Gene: EFNB1
  • Alternative Gene Names: CFNS, Elk-L, EPLG2, LERK2

ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human EFNB1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
VGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000031217 (93%)
  • Rat ENSRNOG00000006877 (92%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.