Atlas Antibodies Anti-EFCAB1 Antibody

상품 한눈에 보기

Human EFCAB1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증을 거침. EF-hand calcium binding domain 1 타깃. 고순도 Affinity 정제. RNA-seq 및 재조합 발현 기반 정밀 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069955-100 Anti-EFCAB1 Antibody, EF-hand calcium binding domain 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069955-25 Anti-EFCAB1 Antibody, EF-hand calcium binding domain 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

EF-hand calcium binding domain 1

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Recombinant expression validation in WB using target protein overexpression.

Polyclonal antibody against Human EFCAB1

항목	내용
Target Protein	EF-hand calcium binding domain 1
Target Gene	EFCAB1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPN
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000050091 (97%), Mouse ENSMUSG00000068617 (97%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand