CacheBy
Atlas Antibodies Anti-EEF1E1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EEF1E1 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human EEF1E1 (AIMP3, P18). Validated for IHC and WB applications. Affinity purified using PrEST antigen. Supplied in PBS with 40% glycerol and 0.02% sodium azide preservative.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027901-100 Anti-EEF1E1 Antibody, eukaryotic translation elongation factor 1 epsilon 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027901-25 Anti-EEF1E1 Antibody, eukaryotic translation elongation factor 1 epsilon 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EEF1E1 Antibody

Anti-EEF1E1 Antibody

Target: eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1)
Type: Polyclonal Antibody against Human EEF1E1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human EEF1E1.
Validated for multiple applications and affinity purified using the PrEST antigen.


Alternative Gene Names

  • AIMP3
  • P18

Open Datasheet


Target Information

항목 내용
Target Protein eukaryotic translation elongation factor 1 epsilon 1
Target Gene EEF1E1
Verified Species Reactivity Human
Interspecies Identity Mouse (85%), Rat (83%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.