CacheBy
Atlas Antibodies Anti-EDC3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-EDC3 Antibody

상품 한눈에 보기

Human EDC3 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 40% glycerol과 PBS buffer에 보존되어 있습니다. Human에 대해 검증된 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040650-100 Anti-EDC3 Antibody, enhancer of mRNA decapping 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040650-25 Anti-EDC3 Antibody, enhancer of mRNA decapping 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-EDC3 Antibody

Anti-EDC3 Antibody

Target Information

  • Target Protein: enhancer of mRNA decapping 3
  • Target Gene: EDC3
  • Alternative Gene Names: FLJ21128, hYjeF_N2-15q23, LSM16, YJDC, YJEFN2

Product Description

Polyclonal Antibody against Human EDC3

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    WLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQN

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000019579 95%
Mouse ENSMUSG00000038957 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.