Atlas Antibodies Anti-ECM1 Antibody

상품 한눈에 보기

Human ECM1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반 Orthogonal validation을 거쳤으며, PrEST 항원으로 Affinity purification되었습니다. ECM1 발현 연구 및 조직 단백질 분석에 유용합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA076029-100 Anti-ECM1 Antibody, extracellular matrix protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA076029-25 Anti-ECM1 Antibody, extracellular matrix protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ECM1 Antibody

Anti-ECM1 Antibody

Target: extracellular matrix protein 1 (ECM1)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human ECM1
Open Datasheet

Product Specifications

항목	내용
Target Protein	Extracellular matrix protein 1
Target Gene	ECM1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	EDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVS
Verified Species Reactivity	Human
Interspecies Identity	Rat (79%, ENSRNOG00000021166), Mouse (76%, ENSMUSG00000028108)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.