CacheBy
Atlas Antibodies Anti-ECM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ECM1 Antibody

상품 한눈에 보기

Human ECM1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. RNA-seq 데이터 기반 Orthogonal validation을 거쳤으며, PrEST 항원으로 Affinity purification되었습니다. ECM1 발현 연구 및 조직 단백질 분석에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076029-100 Anti-ECM1 Antibody, extracellular matrix protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076029-25 Anti-ECM1 Antibody, extracellular matrix protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ECM1 Antibody

Anti-ECM1 Antibody

Target: extracellular matrix protein 1 (ECM1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human ECM1
Open Datasheet


Product Specifications

항목 내용
Target Protein Extracellular matrix protein 1
Target Gene ECM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVS
Verified Species Reactivity Human
Interspecies Identity Rat (79%, ENSRNOG00000021166), Mouse (76%, ENSMUSG00000028108)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.