CacheBy
Atlas Antibodies Anti-ECHS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ECHS1 Antibody

상품 한눈에 보기

Human ECHS1 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Independent validation으로 높은 신뢰성 확보. Affinity purification으로 높은 순도 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021995-100 Anti-ECHS1 Antibody, enoyl CoA hydratase, short chain, 1, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021995-25 Anti-ECHS1 Antibody, enoyl CoA hydratase, short chain, 1, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ECHS1 Antibody

Anti-ECHS1 Antibody

Target: enoyl CoA hydratase, short chain, 1, mitochondrial
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human ECHS1


Alternative Gene Names

  • SCEH

Target Information

항목 내용
Target Protein enoyl CoA hydratase, short chain, 1, mitochondrial
Target Gene ECHS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000025465 (86%), Rat ENSRNOG00000047565 (85%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

ANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMM

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.