CacheBy
Atlas Antibodies Anti-ECE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ECE1 Antibody

상품 한눈에 보기

Human ECE1을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 유사도를 보입니다. PBS와 glycerol buffer에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013616-100 Anti-ECE1 Antibody, endothelin converting enzyme 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013616-25 Anti-ECE1 Antibody, endothelin converting enzyme 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ECE1 Antibody

Anti-ECE1 Antibody

Target Information

  • Target Protein: endothelin converting enzyme 1
  • Target Gene: ECE1
  • Alternative Gene Names: ECE
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ECE1, produced in rabbit.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    IMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKR

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000014241 98%
Mouse ENSMUSG00000057530 98%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.