CacheBy
Atlas Antibodies Anti-DZIP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DZIP3 Antibody

상품 한눈에 보기

Human DZIP3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 연구용으로 적합. 높은 종간 보존성(마우스 95%, 랫 94%)을 가지며 PrEST 항원으로 친화 정제됨. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035066-100 Anti-DZIP3 Antibody, DAZ interacting zinc finger protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035066-25 Anti-DZIP3 Antibody, DAZ interacting zinc finger protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DZIP3 Antibody

Anti-DZIP3 Antibody

Target Protein: DAZ interacting zinc finger protein 3
Alternative Gene Names: hRUL138, PPP1R66

Product Description

Polyclonal antibody against human DZIP3.

Immunohistochemistry (IHC)

Target Information

  • Target Gene: DZIP3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPKKGWNMEPPSSDISKSADILRLCKYRDILLSEILMNGLTESQFNSIWK

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000064061 (95%)
  • Rat: ENSRNOG00000001956 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.