Atlas Antibodies Anti-DUSP9 Antibody

상품 한눈에 보기

Human DUSP9 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. MKP-4/MKP4로도 알려진 DUSP9 단백질 검출에 적합하며, Affinity purification 방식으로 높은 특이성과 재현성을 보장.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003336-100 Anti-DUSP9 Antibody, dual specificity phosphatase 9 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003336-25 Anti-DUSP9 Antibody, dual specificity phosphatase 9 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Dual specificity phosphatase 9

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human DUSP9

MKP-4, MKP4

항목	내용
Target Protein	Dual specificity phosphatase 9
Target Gene	DUSP9
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCLGSDCSDAESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQI
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000031383 (82%), Rat ENSRNOG00000055185 (80%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand