CacheBy
Atlas Antibodies Anti-DUSP22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUSP22 Antibody

상품 한눈에 보기

Human DUSP22 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증 완료. 높은 종간 보존성을 가지며, PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤 및 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031394-100 Anti-DUSP22 Antibody, dual specificity phosphatase 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031394-25 Anti-DUSP22 Antibody, dual specificity phosphatase 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUSP22 Antibody

Anti-DUSP22 Antibody

Target: Dual specificity phosphatase 22 (DUSP22)
Type: Polyclonal Antibody against Human DUSP22


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human DUSP22. Validated for multiple applications with high specificity.


Alternative Gene Names

JKAP, JSP1, MKPX, VHX


Target Information

항목 내용
Target Protein Dual specificity phosphatase 22
Target Gene DUSP22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000069255 (94%), Rat ENSRNOG00000056376 (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.