Atlas Antibodies Anti-DUSP15 Antibody

상품 한눈에 보기

Human DUSP15 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. PBS/glycerol buffer에 sodium azide 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA076649-100 Anti-DUSP15 Antibody, dual specificity phosphatase 15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA076649-25 Anti-DUSP15 Antibody, dual specificity phosphatase 15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DUSP15 Antibody

Anti-DUSP15 Antibody

Dual Specificity Phosphatase 15 (DUSP15)에 대한 폴리클로날 항체입니다.

Recommended Applications

IHC (Orthogonal validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human DUSP15.

Alternative Gene Names

bA243J16.5, bA243J16.6, C20orf57, FLJ20645, VHY

Open Datasheet

Target Information

항목	내용
Target Protein	Dual specificity phosphatase 15
Target Gene	DUSP15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000046776 (35%), Mouse ENSMUSG00000015461 (31%)

Antigen sequence:
ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand