CacheBy
Atlas Antibodies Anti-DUSP15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUSP15 Antibody

상품 한눈에 보기

Human DUSP15 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. PBS/glycerol buffer에 sodium azide 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076649-100 Anti-DUSP15 Antibody, dual specificity phosphatase 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076649-25 Anti-DUSP15 Antibody, dual specificity phosphatase 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUSP15 Antibody

Anti-DUSP15 Antibody

Dual Specificity Phosphatase 15 (DUSP15)에 대한 폴리클로날 항체입니다.


  • IHC (Orthogonal validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human DUSP15.


Alternative Gene Names

bA243J16.5, bA243J16.6, C20orf57, FLJ20645, VHY

Open Datasheet


Target Information

항목 내용
Target Protein Dual specificity phosphatase 15
Target Gene DUSP15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000046776 (35%), Mouse ENSMUSG00000015461 (31%)

Antigen sequence:
ICLCFGEEDPGPTQHPKEQLIMADVQVQLRPGSSSCTLSASTERPDGSSTPGNPDGITHLQCSCLHPKRA


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.