CacheBy
Atlas Antibodies Anti-DUS1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DUS1L Antibody

상품 한눈에 보기

Human DUS1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023384-100 Anti-DUS1L Antibody, dihydrouridine synthase 1-like (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023384-25 Anti-DUS1L Antibody, dihydrouridine synthase 1-like (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DUS1L Antibody

Anti-DUS1L Antibody

Target Information

  • Target Protein: dihydrouridine synthase 1-like (S. cerevisiae)
  • Target Gene: DUS1L
  • Alternative Gene Names: DUS1, PP3111
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human DUS1L

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LTVHGRTKEQKGPLSGAASWEHIKAVRKAVAIPVFANGNIQCLQDVERCLRDTGVQGVMSAEGNLHNPALFEGRSPAVWELAEEYLDIVREH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000025155 92%
Rat ENSRNOG00000047905 90%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.