
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DTL Antibody
상품 한눈에 보기
인간 DTL 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼에서 생산된 IgG 형식입니다. DCAF2, L2DTL, RAMP 유전자 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028016-100 Anti-DTL Antibody, denticleless E3 ubiquitin protein ligase homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028016-25 Anti-DTL Antibody, denticleless E3 ubiquitin protein ligase homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DTL Antibody
Anti-DTL Antibody
Target Protein: denticleless E3 ubiquitin protein ligase homolog (Drosophila)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human DTL.
Alternative Gene Names
- DCAF2
- L2DTL
- RAMP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | denticleless E3 ubiquitin protein ligase homolog (Drosophila) |
| Target Gene | DTL |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIF |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000037474): 97%
- Rat (ENSRNOG00000004195): 95%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



