CacheBy
Atlas Antibodies Anti-DTL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DTL Antibody

상품 한눈에 보기

인간 DTL 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼에서 생산된 IgG 형식입니다. DCAF2, L2DTL, RAMP 유전자 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028016-100 Anti-DTL Antibody, denticleless E3 ubiquitin protein ligase homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028016-25 Anti-DTL Antibody, denticleless E3 ubiquitin protein ligase homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DTL Antibody

Anti-DTL Antibody

Target Protein: denticleless E3 ubiquitin protein ligase homolog (Drosophila)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DTL.


Alternative Gene Names

  • DCAF2
  • L2DTL
  • RAMP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein denticleless E3 ubiquitin protein ligase homolog (Drosophila)
Target Gene DTL
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence TVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLILDSTGSTLFANCTDDNIYMFNMTGLKTSPVAIF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000037474): 97%
  • Rat (ENSRNOG00000004195): 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.