CacheBy
Atlas Antibodies Anti-DSN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DSN1 Antibody

상품 한눈에 보기

Human DSN1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002813-100 Anti-DSN1 Antibody, DSN1, MIS12 kinetochore complex component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002813-25 Anti-DSN1 Antibody, DSN1, MIS12 kinetochore complex component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DSN1 Antibody

Anti-DSN1 Antibody

DSN1, MIS12 kinetochore complex component

  • IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human DSN1

Alternative Gene Names

C20orf172, dJ469A13.2, hKNL-3, KNL3, MIS13

Open Datasheet

Target Information

항목 내용
Target Protein DSN1, MIS12 kinetochore complex component
Target Gene DSN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse: 74% (ENSMUSG00000027635), Rat: 74% (ENSRNOG00000006236)

Antigen Sequence

KEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKITEVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVKQLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.