CacheBy
Atlas Antibodies Anti-DSCAML1 Antibody
원본

Atlas Antibodies Anti-DSCAML1 Antibody

상품 한눈에 보기

Human DSCAML1 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가집니다. 40% glycerol/PBS 완충액에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035230-100 Anti-DSCAML1 Antibody, Down syndrome cell adhesion molecule like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035230-25 Anti-DSCAML1 Antibody, Down syndrome cell adhesion molecule like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DSCAML1 Antibody

Anti-DSCAML1 Antibody

Target: Down syndrome cell adhesion molecule like 1 (DSCAML1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human DSCAML1.


Alternative Gene Names

  • KIAA1132

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Down syndrome cell adhesion molecule like 1
Target Gene DSCAML1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LARTYHTQARHLTLDPASKSLGLPHPGAPAAASTATLPQRTLAMPAPPAGTAPPAPGPTPAEPPTAPSAAPPAPSTEPPRAGGPHTKMGGSRDSLLEMST
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000032087 (91%), Rat ENSRNOG00000016502 (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.