Atlas Antibodies Anti-DSCAM Antibody

상품 한눈에 보기

Human DSCAM 단백질을 표적으로 하는 폴리클로날 Rabbit IgG 항체. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal validation 수행. 고순도 Affinity 정제 및 안정적 PBS/glycerol buffer 포뮬레이션.

카탈로그번호: HPA057493-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057493-100 Anti-DSCAM Antibody, DS cell adhesion molecule 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057493-25 Anti-DSCAM Antibody, DS cell adhesion molecule 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DSCAM Antibody

Anti-DSCAM Antibody

Down syndrome cell adhesion molecule

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human DSCAM

Alternative Gene Names

CHD2-42, CHD2-52

Open Datasheet

Target Information

항목	내용
Target Protein	Down syndrome cell adhesion molecule
Target Gene	DSCAM
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence	PRAQLLIEERDTMETIDDRSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000027992	99%
Mouse	ENSMUSG00000050272	99%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand