CacheBy
Atlas Antibodies Anti-DRGX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DRGX Antibody

상품 한눈에 보기

Human DRGX 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 실험에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 제조됨. 인간에 대한 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가짐. 40% 글리세롤 및 PBS 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043978-100 Anti-DRGX Antibody, dorsal root ganglia homeobox 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043978-25 Anti-DRGX Antibody, dorsal root ganglia homeobox 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DRGX Antibody

Anti-DRGX Antibody

Target: Dorsal root ganglia homeobox (DRGX)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DRGX protein.

Alternative Gene Names

  • DRG11
  • PRRXL1

Open Datasheet

Target Information

항목 내용
Target Protein Dorsal root ganglia homeobox
Target Gene DRGX
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (91%), Rat (88%)

Antigen Sequence:
PMGLSFLPTYGCQSNRTASVATLRMKAREHSEAVLQSANLLPSTSSSPGPVAKPAPPDGSQEKTSPTKEQSEAEKSV

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.