CacheBy
Atlas Antibodies Anti-DRG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DRG1 Antibody

상품 한눈에 보기

인간 DRG1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 특이적 정제되었으며 인간, 생쥐, 랫드에 반응합니다. 안정한 PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001218-100 Anti-DRG1 Antibody, developmentally regulated GTP binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001218-25 Anti-DRG1 Antibody, developmentally regulated GTP binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DRG1 Antibody

Anti-DRG1 Antibody

developmentally regulated GTP binding protein 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human DRG1

Alternative Gene Names

  • NEDD3

Open Datasheet

Target Information

항목 내용
Target Protein developmentally regulated GTP binding protein 1
Target Gene DRG1
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000018590 (100%), Mouse ENSMUSG00000020457 (100%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYT

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.