CacheBy
Atlas Antibodies Anti-DRAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DRAP1 Antibody

상품 한눈에 보기

Human DRAP1 단백질을 인식하는 폴리클로날 항체로, IHC, WB(재조합 발현), ICC 등 다양한 응용에 적합. Rabbit 호스트에서 생산되었으며 PrEST 항원으로 친화 정제됨. 높은 종 간 서열 동일성으로 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006790-100 Anti-DRAP1 Antibody, DR1-associated protein 1 (negative cofactor 2 alpha) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006790-25 Anti-DRAP1 Antibody, DR1-associated protein 1 (negative cofactor 2 alpha) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DRAP1 Antibody

Anti-DRAP1 Antibody

DR1-associated protein 1 (negative cofactor 2 alpha)

  • Immunohistochemistry (IHC)
  • Western Blot (Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DRAP1

Alternative Gene Names

  • NC2-alpha

Open Datasheet

Target Information

항목 내용
Target Protein DR1-associated protein 1 (negative cofactor 2 alpha)
Target Gene DRAP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000020527 (96%), Mouse ENSMUSG00000024914 (95%)

Antigen Sequence

RIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQ

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.