CacheBy
Atlas Antibodies Anti-DPRX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DPRX Antibody

상품 한눈에 보기

Human DPRX 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형태로 제공. 인체 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043682-100 Anti-DPRX Antibody, divergent-paired related homeobox 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043682-25 Anti-DPRX Antibody, divergent-paired related homeobox 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DPRX Antibody

Anti-DPRX Antibody

Target: Divergent-paired related homeobox (DPRX)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human DPRX protein.

Open Datasheet (PDF)

Target Information

  • Target Protein: Divergent-paired related homeobox
  • Target Gene: DPRX
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVPANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000002204 (25%)
  • Mouse ENSMUSG00000022178 (23%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.