CacheBy
Atlas Antibodies Anti-SHMT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SHMT2 Antibody

상품 한눈에 보기

인간 SHMT2 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 Rabbit IgG 항체이며, Orthogonal 및 Independent validation을 통해 검증됨. 인간, 마우스, 랫트 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020543-100 Anti-SHMT2 Antibody, serine hydroxymethyltransferase 2 (mitochondrial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020543-25 Anti-SHMT2 Antibody, serine hydroxymethyltransferase 2 (mitochondrial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SHMT2 Antibody

Anti-SHMT2 Antibody

Target: Serine hydroxymethyltransferase 2 (mitochondrial)


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human SHMT2.


Alternative Gene Names

  • SHMT

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Serine hydroxymethyltransferase 2 (mitochondrial)
Target Gene SHMT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000025403 (90%), Rat ENSRNOG00000008106 (88%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.