CacheBy
Atlas Antibodies Anti-SHCBP1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SHCBP1L Antibody

상품 한눈에 보기

인간 SHCBP1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. RNA-seq 데이터 기반 직교 검증 완료. 인간 시료 분석에 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036124-100 Anti-SHCBP1L Antibody, SHC SH2-domain binding protein 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036124-25 Anti-SHCBP1L Antibody, SHC SH2-domain binding protein 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SHCBP1L Antibody

Anti-SHCBP1L Antibody

SHC SH2-domain binding protein 1-like


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human SHCBP1L.


Alternative Gene Names

  • C1orf14

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant PrEST antigen):
CVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF


Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000002691 (79%)
  • Mouse ENSMUSG00000042708 (76%)

Specifications

항목 내용
Target Protein SHC SH2-domain binding protein 1-like
Target Gene SHCBP1L
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.