CacheBy
Atlas Antibodies Anti-SH3YL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SH3YL1 Antibody

상품 한눈에 보기

인간 SH3YL1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었고, 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030926-100 Anti-SH3YL1 Antibody, SH3 and SYLF domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030926-25 Anti-SH3YL1 Antibody, SH3 and SYLF domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SH3YL1 Antibody

Anti-SH3YL1 Antibody

SH3 and SYLF domain containing 1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human SH3YL1.

Alternative Gene Names

  • DKFZP586F1318
  • Ray

Open Datasheet

Target Information

항목 내용
Target Protein SH3 and SYLF domain containing 1
Target Gene SH3YL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (93%), Rat (93%)

Antigen Sequence:

FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Base PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.