CacheBy
Atlas Antibodies Anti-SH3TC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SH3TC2 Antibody

상품 한눈에 보기

인간 SH3TC2 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 토끼에서 생산된 IgG 형식. PrEST 항원을 이용해 친화 정제되어 높은 특이성과 재현성을 제공. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037683-100 Anti-SH3TC2 Antibody, SH3 domain and tetratricopeptide repeats 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037683-25 Anti-SH3TC2 Antibody, SH3 domain and tetratricopeptide repeats 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SH3TC2 Antibody

Anti-SH3TC2 Antibody

Target: SH3 domain and tetratricopeptide repeats 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SH3TC2.

Alternative Gene Names: CMT4C, KIAA1985
Target Protein: SH3 domain and tetratricopeptide repeats 2
Target Gene: SH3TC2

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTECSSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000019305 (73%)
  • Mouse ENSMUSG00000045629 (72%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.