
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SH3TC1 Antibody
상품 한눈에 보기
인간 SH3TC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤과 PBS 완충액에 보존되어 안정적이며, 다양한 연구용으로 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056807-100 Anti-SH3TC1 Antibody, SH3 domain and tetratricopeptide repeats 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056807-25 Anti-SH3TC1 Antibody, SH3 domain and tetratricopeptide repeats 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SH3TC1 Antibody
Anti-SH3TC1 Antibody
Target: SH3 domain and tetratricopeptide repeats 1 (SH3TC1)
Clonality: Polyclonal
Host: Rabbit
Applications: IHC, WB
Product Description
Polyclonal antibody against human SH3TC1. This antibody is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- FLJ20356
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SH3 domain and tetratricopeptide repeats 1 |
| Target Gene | SH3TC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000007993 (63%), Mouse ENSMUSG00000036553 (63%) |
Antigen Sequence:
RTVVMRPSVSWEKAGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLR
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



