Atlas Antibodies Anti-SH3TC1 Antibody

상품 한눈에 보기

인간 SH3TC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤과 PBS 완충액에 보존되어 안정적이며, 다양한 연구용으로 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056807-100 Anti-SH3TC1 Antibody, SH3 domain and tetratricopeptide repeats 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056807-25 Anti-SH3TC1 Antibody, SH3 domain and tetratricopeptide repeats 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: SH3 domain and tetratricopeptide repeats 1 (SH3TC1)
Clonality: Polyclonal
Host: Rabbit
Applications: IHC, WB

Polyclonal antibody against human SH3TC1. This antibody is affinity purified using the PrEST antigen as the affinity ligand.

항목	내용
Target Protein	SH3 domain and tetratricopeptide repeats 1
Target Gene	SH3TC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000007993 (63%), Mouse ENSMUSG00000036553 (63%)

Antigen Sequence:
RTVVMRPSVSWEKAGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLR

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen