CacheBy
Atlas Antibodies Anti-SH3BP5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SH3BP5 Antibody

상품 한눈에 보기

인체 SH3BP5 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 정제된 Rabbit IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036445-100 Anti-SH3BP5 Antibody, SH3-domain binding protein 5 (BTK-associated) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036445-25 Anti-SH3BP5 Antibody, SH3-domain binding protein 5 (BTK-associated) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SH3BP5 Antibody

Anti-SH3BP5 Antibody

SH3-domain binding protein 5 (BTK-associated)


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Orthogonal validation)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SH3BP5


Alternative Gene Names

  • Sab

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SH3-domain binding protein 5 (BTK-associated)
Target Gene SH3BP5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLPSPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRG

Species Reactivity

  • Verified Species: Human
  • Ortholog Identity:
    • Mouse (ENSMUSG00000021892): 95%
    • Rat (ENSRNOG00000052391): 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.