
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SH3BP5 Antibody
상품 한눈에 보기
인체 SH3BP5 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 정제된 Rabbit IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었으며, 마우스 및 랫트와 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036445-100 Anti-SH3BP5 Antibody, SH3-domain binding protein 5 (BTK-associated) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036445-25 Anti-SH3BP5 Antibody, SH3-domain binding protein 5 (BTK-associated) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SH3BP5 Antibody
Anti-SH3BP5 Antibody
SH3-domain binding protein 5 (BTK-associated)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SH3BP5
Alternative Gene Names
- Sab
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SH3-domain binding protein 5 (BTK-associated) |
| Target Gene | SH3BP5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLPSPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRG |
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000021892): 95%
- Rat (ENSRNOG00000052391): 95%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



