AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SH3BGR Antibody
상품 한눈에 보기
Human SH3BGR 단백질을 인식하는 폴리클로날 항체로, IHC 기반 Orthogonal 검증을 통해 단백질 발현이 확인됨. Rabbit 유래 IgG 형식으로, Affinity purification 방식으로 정제됨. PBS/glycerol buffer에 보존되어 연구용으로 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030690-100 Anti-SH3BGR Antibody, SH3 domain binding glutamate-rich protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030690-25 Anti-SH3BGR Antibody, SH3 domain binding glutamate-rich protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SH3BGR Antibody
Anti-SH3BGR Antibody
SH3 domain binding glutamate-rich protein
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SH3BGR
Alternative Gene Names
21-GARP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SH3 domain binding glutamate-rich protein |
| Target Gene | SH3BGR |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Epitope Sequence | MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVL |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000030775 | 34% |
| Mouse | ENSMUSG00000052551 | 34% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.