CacheBy
Atlas Antibodies Anti-SGTA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SGTA Antibody

상품 한눈에 보기

Human SGTA 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056309-100 Anti-SGTA Antibody, small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056309-25 Anti-SGTA Antibody, small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SGTA Antibody

Anti-SGTA Antibody

Human SGTA 단백질(small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha)을 인식하는 Rabbit Polyclonal 항체입니다.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SGTA

Alternative Gene Names

SGT

Open Datasheet

Target Information

항목 내용
Target Protein small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha
Target Gene SGTA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019891 (88%), Mouse ENSMUSG00000004937 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.